General Information

  • ID:  hor004027
  • Uniprot ID:  A0A7M6UV78(32-80)
  • Protein name:  Pyrokinin-1
  • Gene name:  100313507
  • Organism:  Nasonia vitripennis (Parasitic wasp)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nasonia (genus), Pteromalinae (subfamily), Pteromalidae (family), Chalcidoidea (superfamily), Parasitoida (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QYDGRGSDMVEGPRVERMHPETSGGCVGAHCLTQNSEGPVGAMWFGPRL
  • Length:  49(32-80)
  • Propeptide:  MELARLINGARTKAILCALLVIVLMANRVAGQYDGRGSDMVEGPRVERMHPETSGGCVGAHCLTQNSEGPVGAMWFGPRLGRRRRSDKFTPKKIEALSEMLGSPNWNLVTIPGGEDKRQETTFTPRLGRELENAISVYDLVRGLVSSVDDQNGKDRDQQAPPPMFPPRLGRTLLTPRLEHELRNLLRKLQMQ
  • Signal peptide:  MELARLINGARTKAILCALLVIVLMANRVAG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M6UV78-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004027_AF2.pdbhor004027_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 611720 Formula: C221H341N69O71S5
Absent amino acids: IK Common amino acids: G
pI: 5.53 Basic residues: 6
Polar residues: 18 Hydrophobic residues: 10
Hydrophobicity: -62.04 Boman Index: -9388
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 43.67
Instability Index: 2531.43 Extinction Coefficient cystines: 7115
Absorbance 280nm: 148.23

Literature

  • PubMed ID:  20695486
  • Title:  Genomics and Peptidomics of Neuropeptides and Protein Hormones Present in the Parasitic Wasp Nasonia Vitripennis